Cagrilintide 5mg

Cagrilintide

Product Overview

Cagrilintide is an innovative synthetic peptide designed as a long-acting amylin analogue. Naturally occurring amylin is co-secreted with insulin by pancreatic beta cells to assist in glycemic regulation and satiety, but its brief biological half-life limits its utility in long-term laboratory models. Cagrilintide overcomes this limitation through precise structural modifications, including acylation via an eicosanedioic acid fatty acid chain attached to a glutamic acid spacer, which allows it to bind to albumin and resist rapid enzymatic degradation.

In metabolic research, Cagrilintide is a highly watched compound due to its distinct, non-incretin mechanism of action. Unlike GLP-1 or GIP analogs that target incretin receptors, Cagrilintide operates as a non-selective agonist of both the amylin receptor (AMYR) complexes and calcitonin receptors (CTR). By binding to these target receptors primarily within the hindbrain (such as the area postrema), it allows researchers to study central appetite-suppressing pathways, the deceleration of gastric motility, and homeostatic energy balance. It is a fundamental tool for exploring independent or synergistic multi-pathway metabolic interventions.

Research Applications

Cagrilintide is commonly utilized in laboratory settings for investigations involving:

• Amylin receptor (AMYR) and calcitonin receptor (CTR) binding and activation models

• Central nervous system satiety signaling and appetite-regulation pathways

• Gastric emptying deceleration and postprandial glucose entry kinetics

• Lipid metabolism, adipose tissue reduction, and body composition changes

• Glucagon secretion suppression models in pancreatic cells

• Dual-mechanism metabolic signaling when paired with GLP-1 receptor agonists (e.g., in CagriSema research models)

• Differences in homeostatic vs. hedonic (reward-driven) food intake pathways

• Long-term pharmacokinetic profiling of acylated peptides

Researchers continue to explore Cagrilintide’s interactions with various biological systems to better understand its potential applications in preclinical and translational research environments.

Peptide Information

• Peptide Name: Cagrilintide

• Sequence Shortening: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge: Cys3-Cys8)

• Molecular Classification: Long-Acting Acylated Amylin Analogue

• Research Category: Metabolic Regulation and Satiety Signaling Research Peptide

Storage

Store lyophilized Cagrilintide in a cool, dry environment away from direct light. For long-term storage, deep freezing at -20°C (or lower) under desiccated conditions is highly recommended to preserve molecular integrity and prevent degradation.

Research Use Only

This product is intended exclusively for laboratory research and analytical purposes.

Not for human consumption. Not for medical, veterinary, household, cosmetic, or food use. This product is not a drug and has not been approved by the U.S. Food and Drug Administration for the diagnosis, treatment, cure, or prevention of any disease. All purchasers are responsible for ensuring compliance with applicable laws and regulations governing research compounds.